Host taxon 10090
Protein NP_084126.1
B-cell CLL/lymphoma 7 protein family member A
Mus musculus
Gene Bcl7a, UniProt Q9CXE2
>NP_084126.1|Pseudomona aeruginosa PA01|B-cell CLL/lymphoma 7 protein family member A
MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPETNPPVPSDGTEAKADEAQADGKEHPGAEDASEEQNSQSSMENSVNSSEKAERQPSAESGLAAETSAVSQDLEGVPPSKKMKLEASQQNSEEM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.84 | -2.84151679832125 | 5.2e-14 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)