Host taxon 10090
Protein NP_031562.1
B cell leukemia/lymphoma 2 related protein A1d
Mus musculus
Gene Bcl2a1d, UniProt O55179
>NP_031562.1|Pseudomona aeruginosa PA01|B cell leukemia/lymphoma 2 related protein A1d
MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIMNNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.88 | 1.87598097179008 | 4.4e-12 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)