Host taxon 10090
Protein NP_080146.1
ATPase SWSAP1
Mus musculus
Gene Swsap1, UniProt Q8VCI7
>NP_080146.1|Pseudomona aeruginosa PA01|ATPase SWSAP1
MAEALRRVLNAGCAARPGEDGAAGPPLLLLGAPRSAQTSLLFAAALEAAGEGRGSVLFVTRRPLQSLPLSTPTAREHWRLQKVRFQYPSSIQELLQLLASAHEAPAPTPSLLLLDGLEEYLAEDPSAQEAAYLAALLLDTAAFFSHRLGANGSCGLVVALETQKEAEADAPHLPLLKRYFPAQCWLQPDALGLGQHCCLRASLELGKLSPRTEWSVSFLPCGEMKVTPWLAQASKLSPEKKDSSAGSQSLTLGCDNLPGPGSPLDGILTSETGADSKT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.64 | -2.64033050786154 | 6.0e-6 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)