Bacterial taxon 208964
Protein WP_003098129.1
ATP-dependent Clp endopeptidase proteolytic subunit ClpP
Pseudomona aeruginosa PA01
Gene clpP1, UniProt Q9I2U1
>WP_003098129.1|Pseudomona aeruginosa PA01|ATP-dependent Clp endopeptidase proteolytic subunit ClpP
MSRNSFIPHVPDIQAAGGLVPMVVEQSARGERAYDIYSRLLKERIIFLVGQVEDYMANLVVAQLLFLEAENPEKDIHLYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGALLLAGGAAGKRYCLPHSRMMIHQPLGGFQGQASDIEIHAKEILFIKERLNQILAHHTGQPLDVIARDTDRDRFMSGDEAVKYGLIDKVMTQRDLAV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ -0.58 | -0.575239626054863 | 5.9e-24 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)