Host taxon 10090
Protein NP_080812.1
ATP synthase subunit s, mitochondrial precursor
Mus musculus
Gene Dmac2l, UniProt Q9CRA7
>NP_080812.1|Pseudomona aeruginosa PA01|ATP synthase subunit s, mitochondrial precursor
MMMFGKISRQLCSLKKIPWSCDSRYFWEWLNTVFNKVDYERLRDVGPDRAASEWLLRCGAKVRYCGHQKWLHDYNTLPGSSIDRYKIQAIDATDSCIMDIGLDHMVGLEHVEKITLCKCHYIEDNCLQRLSQLENLRKSLLELEIIACGNVTDNGVIALRHFRNLKYLFLSDLPGVKDKEYLAQVFKTALPSLELKLNLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.54 | -1.53703438004225 | 0.018 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)