Host taxon 10090
Protein NP_079589.2
ATP synthase subunit delta, mitochondrial isoform 1 precursor
Mus musculus
Gene Atp5d, UniProt Q4FK74
>NP_079589.2|Pseudomona aeruginosa PA01|ATP synthase subunit delta, mitochondrial isoform 1 precursor
MLPASLLRHPGLRRLMLQARTYAEAAAAPAPAAGPGQMSFTFASPTQVFFDSANVKQVDVPTLTGAFGILASHVPTLQVLRPGLVVVHTEDGTTTKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAARANLEKAQSELSGAADEAARAEIQIRIEANEALVKALE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.55 | -0.55458898066568 | 0.00011 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)