Host taxon 10090
Protein NP_082415.2
ataxin-7-like protein 1 isoform 2
Mus musculus
Gene Atxn7l1, UniProt Q9CZ05
>NP_082415.2|Pseudomona aeruginosa PA01|ataxin-7-like protein 1 isoform 2
MTSERSRIPCLSAAAAEGTGKKQQEGTAMATLHRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKEDMHLFGHYPAHDDFYLVVCSACNQVVKPQVFQSHCGRKQDSKRNASISWSGAESRQALEQRQV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.47 | 0.473910691178017 | 0.0012 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)