Host taxon 10090
Protein NP_663482.2
aspartate--tRNA ligase, cytoplasmic isoform 2
Mus musculus
Gene Dars, UniProt Q8BJY7
>NP_663482.2|Pseudomona aeruginosa PA01|aspartate--tRNA ligase, cytoplasmic isoform 2
MPSTNASRKGQEKPREIVDAAEDYAKERYGISSMIQSQEKPDRVLVRVKDLTVQKADDVVWVRARVHTSRAKDWEPTDRLFFLFFNY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.06 | -1.05648627120315 | 1.1e-5 | 32071273 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)