Host taxon 10090
Protein NP_808446.1
armadillo repeat-containing protein 7 isoform 1
Mus musculus
Gene Armc7, UniProt Q3UJZ3
>NP_808446.1|Pseudomona aeruginosa PA01|armadillo repeat-containing protein 7 isoform 1
MAQKPKIDPHVGRLGYLQALVTEFQETESQDAKEQVLANLANFAYDPGNYQYLRQLQVLDLFLDSLSEENETLIKFAIGGLCNLCADKANKEHVLQAGGLPLIIGCLSSPDEETVLSAVTTLMYLSSPGSRSHPELTSLPVVQCMLRFSISASTRLRNLAQIFLEDFCSPSQVAEAHSQQAHSALGIPLPKTEAPQQP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.97 | 0.971923914870115 | 0.0031 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)