Bacterial taxon 208964
Protein WP_003085950.1
arginine/ornithine succinyltransferase subunit alpha
Pseudomona aeruginosa PA01
Gene astA, UniProt P80357
>WP_003085950.1|Pseudomona aeruginosa PA01|arginine/ornithine succinyltransferase subunit alpha
MLVMRPAQAADLPQVQRLAADSPVGVTSLPDDAERLRDKILASEASFAAEVSYNGEESYFFVLEDSASGELVGCSAIVASAGFSEPFYSFRNETFVHASRSLSIHNKIHVLSLCHDLTGNSLLTSFYVQRDLVQSVYAELNSRGRLLFMASHPERFADAVVVEIVGYSDEQGESPFWNAVGRNFFDLNYIEAEKLSGLKSRTFLAELMPHYPIYVPLLPDAAQESMGQVHPRAQITFDILMREGFETDNYIDIFDGGPTLHARTSGIRSIAQSRVVPVKIGEAPKSGRPYLVTNGQLQDFRAVVLDLDWAPGKPVALSVEAAEALGVGEGASVRLVAV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ 0.77 | 0.770228212381424 | 1.4e-20 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)