Host taxon 10090
Protein NP_081382.1
arginine vasopressin-induced protein 1
Mus musculus
Gene Avpi1, UniProt Q9D7H4
>NP_081382.1|Pseudomona aeruginosa PA01|arginine vasopressin-induced protein 1
MGTPASVVSEPPLWQVSTPQTRGRKQASANIFQDAELVQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALRRLRRKRPPKQNHCSRLRVPEPGSTASDPQASTTDTASSEQSGNSRRTSARAPRNWNKPGPTGYLHQIRH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.93 | 0.925694694078493 | 2.9e-6 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)