Host taxon 10090
Protein NP_033793.1
arachidonate 5-lipoxygenase-activating protein isoform 1 precursor
Mus musculus
Gene Alox5ap, UniProt P30355
>NP_033793.1|Pseudomona aeruginosa PA01|arachidonate 5-lipoxygenase-activating protein isoform 1 precursor
MDQEAVGNVVLLALVTLISVVQNAFFAHKVEHESKAHNGRSFQRTGTLAFERVYTANQNCVDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSFAGILNHYLIFFFGSDFENYIRTVSTTISPLLLIP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.6 | 2.59925984075517 | 3.6e-66 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)