Host taxon 10090
Protein NP_001273333.1
appetite-regulating hormone isoform 2 preproprotein
Mus musculus
Gene Ghrl, UniProt Q9EQX0
>NP_001273333.1|Pseudomona aeruginosa PA01|appetite-regulating hormone isoform 2 preproprotein
MLSSGTICSLLLLSMLWMDMAMAGSSFLSPEHQKAQRKESKKPPAKLQPRALEGWLHPEDRGQAEETEEELEIRFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPADK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.98 | 1.98093514374952 | 2.9e-5 | 32071273 | |
Retrieved 1 of 4 entries in 0.8 ms
(Link to these results)