Host taxon 10090
Protein NP_001103479.1
apolipoprotein C-I precursor
Mus musculus
Gene Apoc1, UniProt P34928
>NP_001103479.1|Pseudomona aeruginosa PA01|apolipoprotein C-I precursor
MRLFIALPVLIVVVAMTLEGPAPAQAAPDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.59 | -1.58963185407322 | 1.8e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)