Host taxon 10090
Protein NP_038940.1
apelin preproprotein
Mus musculus
Gene Apln, UniProt Q9R0R4
>NP_038940.1|Pseudomona aeruginosa PA01|apelin preproprotein
MNLRLCVQALLLLWLSLTAVCGVPLMLPPDGTGLEEGSMRYLVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.04 | -3.03585309352527 | 1.7e-38 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)