Host taxon 10090
Protein NP_033812.3
AP-3 complex subunit sigma-2
Mus musculus
Gene Ap3s2, UniProt Q8BSZ2
>NP_033812.3|Pseudomona aeruginosa PA01|AP-3 complex subunit sigma-2
MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.45 | -1.45318394050473 | 4.4e-9 | 32071273 | |
Retrieved 1 of 2 entries in 1.4 ms
(Link to these results)