Host taxon 10090
Protein NP_033811.1
AP-3 complex subunit sigma-1 isoform 1
Mus musculus
Gene Ap3s1, UniProt Q9DCR2
>NP_033811.1|Pseudomona aeruginosa PA01|AP-3 complex subunit sigma-1 isoform 1
MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.85 | 0.849990229902679 | 0.0013 | 32071273 | |
Retrieved 1 of 3 entries in 1.7 ms
(Link to these results)