Host taxon 10090
Protein NP_001116292.1
AP-3 complex subunit mu-2
Mus musculus
Gene Ap3m2, UniProt Q8R2R9
>NP_001116292.1|Pseudomona aeruginosa PA01|AP-3 complex subunit mu-2
MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVVEEIDAIIDKSGSTVTAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLAYHVSAQNLVAIPVYVKHSISFRDSSSLGRFEITVGPKQTMGKTIEGVIVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMGLQVGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.17 | -1.17220879208073 | 0.0011 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)