Host taxon 10090
Protein NP_031483.1
AP-1 complex subunit sigma-1A
Mus musculus
Gene Ap1s1, UniProt P61967
>NP_031483.1|Pseudomona aeruginosa PA01|AP-1 complex subunit sigma-1A
MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.05 | -1.04932061483099 | 7.0e-5 | 32071273 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)