Host taxon 10090
Protein NP_035913.1
anterior gradient protein 2 homolog precursor
Mus musculus
Gene Agr2, UniProt O88312
>NP_035913.1|Pseudomona aeruginosa PA01|anterior gradient protein 2 homolog precursor
MEKFSVSAILLLVAISGTLAKDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.09 | -3.08877949036972 | 0.05 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)