Host taxon 10090
Protein NP_001268903.1
ankyrin repeat domain-containing protein 10 isoform 3
Mus musculus
Gene Ankrd10, UniProt Q99LW0
>NP_001268903.1|Pseudomona aeruginosa PA01|ankyrin repeat domain-containing protein 10 isoform 3
MSRFCHNGTLSGGHESILPTHVSLGTNRKRCLEDSESLGVKKARTRVPSLDHAMPLANGEAEDDADRMHVDRECAAVSDMKNSSSVLNTLTNGSVVNGHLDFPCANQLNGMESRSHPCLTGSNGVSNGQPLSSGQASVSANGTEEPEKTMGINPEMCGSLHLNGSPSSCVASRPSWVGDIGESLHYGHYHGFGDTAESIPELSSVLEHTSCVRVEQRYDSAVLGAMQLHHGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.77 | -0.767637332865207 | 0.0011 | 32071273 | |
Retrieved 1 of 3 entries in 2 ms
(Link to these results)