Host taxon 10090
Protein NP_647452.1
anaphase-promoting complex subunit CDC26
Mus musculus
Gene Cdc26, UniProt Q99JP4
>NP_647452.1|Pseudomona aeruginosa PA01|anaphase-promoting complex subunit CDC26
MLRRKPTRLELKLDDIEEFESIRKDLEARKKQKEDVEGVGTSDGEGAAGLSSDPKSREQMINDRIGYKPQLKSNNRTSQFGNFEF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.81 | -0.811677274819024 | 0.01 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)