Host taxon 10090
Protein NP_001334380.1
anaphase-promoting complex subunit 16 isoform 2
Mus musculus
Gene Anapc16, UniProt Q9CPV2
>NP_001334380.1|Pseudomona aeruginosa PA01|anaphase-promoting complex subunit 16 isoform 2
MSARSSLSYTNEERLLLEGMAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.61 | -0.614099638849613 | 0.037 | 32071273 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)