Host taxon 10090
Protein NP_852059.1
anaphase-promoting complex subunit 13
Mus musculus
Gene Anapc13, UniProt Q8R034
>NP_852059.1|Pseudomona aeruginosa PA01|anaphase-promoting complex subunit 13
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGGTTESVKEQEMKWTDLALQGLHENVPPAGN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.25 | -1.24968249379305 | 0.02 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)