Host taxon 10090
Protein NP_001033319.1
anaphase-promoting complex subunit 11
Mus musculus
Gene Anapc11, UniProt Q9CPX9
>NP_001033319.1|Pseudomona aeruginosa PA01|anaphase-promoting complex subunit 11
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLNAQQVQQHCPMCRQEWKFKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.83 | -0.83364275640634 | 0.00077 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)