Host taxon 10090
Protein NP_001153380.1
AN1-type zinc finger protein 2A
Mus musculus
Gene Zfand2a, UniProt Q9JII7
>NP_001153380.1|Pseudomona aeruginosa PA01|AN1-type zinc finger protein 2A
MEFPDLGKHCSEPTCKQLDFLPITCDACKQDFCKDHFSYVGHKCPFAFKKDVQVPVCPLCNAPIPVKRGEIPDVVVGEHMDRDCTFHPGRNRNKVFTHRCSKEGCRKKEMLQLACAQCHGNFCIQHRHPLDHNCQAGSSSASRGRTSTSRAAEQKPSGVSWLAQRLRRTVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.3 | 1.30080388376981 | 2.3e-19 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)