Bacterial taxon 208964
Protein WP_003113175.1
aminodeoxychorismate/anthranilate synthase component II
Pseudomona aeruginosa PA01
Gene trpG, UniProt P20576
>WP_003113175.1|Pseudomona aeruginosa PA01|aminodeoxychorismate/anthranilate synthase component II
MLLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAPERIVLSPGPCTPNEAGVSLAVIERFAGKLPLLGVCLGHQSIGQAFGGEVVRARQVMHGKTSPIHHKDLGVFAGLANPLTVTRYHSLVVKRESLPECLEVTAWTQHADGSLDEIMGVRHKTLNVEGVQFHPESILTEQGHELLANFLRQQGGVRGEGN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ 0.37 | 0.367750245349763 | 0.0061 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)