Host taxon 10090
Protein NP_001028607.1
allergin-1 isoform a precursor
Mus musculus
Gene Milr1, UniProt Q3TB92
>NP_001028607.1|Pseudomona aeruginosa PA01|allergin-1 isoform a precursor
MGDGDSPMCLSAVSFKGIRCWLDKLLLWALTISITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLSLLLPGLLLGILVIVLVLAYLIHLKYKKGKKTQREDQSKGSGDAPAQDELYVNACKTQTEQPQEIHYATPVFKEMAPMEEEGGTDGKADYIYSELTH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.74 | 2.74215813375328 | 3.2e-17 | 32071273 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)