Host taxon 10090
Protein NP_001258735.1
agouti-related protein precursor
Mus musculus
Gene Agrp, UniProt P56473
>NP_001258735.1|Pseudomona aeruginosa PA01|agouti-related protein precursor
MLTAMLLSCVLLLALPPTLGVQMGVAPLKGIRRPDQALFPEFPGLSLNGLKKTTADRAEEVLLQKAEALAEVLDPQNRESRSPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -4.46 | -4.45663741666645 | 0.024 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)