Host taxon 10090
Protein NP_001288657.1
adrenodoxin, mitochondrial isoform 2 precursor
Mus musculus
Gene Fdx1, UniProt P46656
>NP_001288657.1|Pseudomona aeruginosa PA01|adrenodoxin, mitochondrial isoform 2 precursor
MAAAPGARLLRAACASVPFRGLDRCRLLVCGTGAGTAISPWTPSPRLHAEAGPGRPLSVSARARSSSEDKITVHFKNRDGETLTTKGKIGDSLLDVVIENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAFGLTDRNLEDPPISFSPAIGP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.38 | 1.37874871186126 | 1.3e-11 | 32071273 | |
Retrieved 1 of 4 entries in 0.7 ms
(Link to these results)