Host taxon 10090
Protein NP_892039.1
ADP-ribosylation factor-like protein 5A
Mus musculus
Gene Arl5a, UniProt Q80ZU0
>NP_892039.1|Pseudomona aeruginosa PA01|ADP-ribosylation factor-like protein 5A
MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVVNNTRFLMWDIGGQESLRPSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.26 | 0.263250176328726 | 0.038 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)