Host taxon 10090
Protein NP_001291503.1
ADP-ribosylation factor 2
Mus musculus
Gene Arf2, UniProt Q8BSL7
>NP_001291503.1|Pseudomona aeruginosa PA01|ADP-ribosylation factor 2
MGNVFEKLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWLSNQLKNQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.22 | 1.21641463372618 | 6.5e-15 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)