Host taxon 10090
Protein NP_079697.1
acylphosphatase-1 isoform 3
Mus musculus
Gene Acyp1, UniProt P56376
>NP_079697.1|Pseudomona aeruginosa PA01|acylphosphatase-1 isoform 3
MAEGDTLVSVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDRGTVQGQLQGPVSKVRFMQQWLETRGSPKSHIDRANFNNEKVIANLDYSDFQIVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.2 | -2.19976279956692 | 0.0042 | 32071273 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)