Host taxon 10090
Protein NP_080066.1
acyl-coenzyme A thioesterase 13
Mus musculus
Gene Acot13, UniProt Q9CQR4
>NP_080066.1|Pseudomona aeruginosa PA01|acyl-coenzyme A thioesterase 13
MSSMTQNLREVMKVMFKVPGFDRVLEKVTLVSAAPEKLICEMKVEEQHTNKLGTLHGGLTATLVDSISTMALMCTERGAPGVSVDMNITYMSPAKIGEEIVITAHILKQGKTLAFASVDLTNKTTGKLIAQGRHTKHLGN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.52 | -1.51717096263301 | 0.0007 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)