Host taxon 10090
Protein NP_082453.2
acyl carrier protein, mitochondrial precursor
Mus musculus
Gene Ndufab1, UniProt Q9CR21
>NP_082453.2|Pseudomona aeruginosa PA01|acyl carrier protein, mitochondrial precursor
MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGTVTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.71 | -0.708555899065877 | 0.032 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)