Host taxon 10090
Protein NP_035424.1
activated RNA polymerase II transcriptional coactivator p15
Mus musculus
Gene Sub1, UniProt P11031
>NP_035424.1|Pseudomona aeruginosa PA01|activated RNA polymerase II transcriptional coactivator p15
MPKSKELVSSSSSGSDSDSEVEKKLKRKKQAVPEKPVKKQKPGETSRALASSKQSSSSRDDNMFQIGKMRYVSVRDFKGKILIDIREYWMDSEGEMKPGRKGISLNMEQWSQLKEQISDIDDAVRKL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.13 | 1.13028591568719 | 7.8e-15 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)