Host taxon 10090
Protein NP_001163956.1
actin-related protein 2/3 complex subunit 4 isoform 2
Mus musculus
Gene Arpc4, UniProt P59999
>NP_001163956.1|Pseudomona aeruginosa PA01|actin-related protein 2/3 complex subunit 4 isoform 2
MADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.5 | 0.500919592375309 | 0.0013 | 32071273 | |
Retrieved 1 of 3 entries in 1.1 ms
(Link to these results)