Host taxon 10090
Protein NP_062798.1
actin-related protein 2/3 complex subunit 3
Mus musculus
Gene Arpc3, UniProt Q9JM76
>NP_062798.1|Pseudomona aeruginosa PA01|actin-related protein 2/3 complex subunit 3
MPAYHSSLMDPDTKLIGNMALLPLRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPASKQEDEMMRAYLQQLRQETGLRLCEKVFDPQSDKPSKWWTCFVKRQFMNKSLSGPGQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.77 | 0.769451445549769 | 4.7e-8 | 32071273 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)