Host taxon 10090
Protein NP_899010.1
actin-associated protein FAM107A isoform 1
Mus musculus
Gene Fam107a, UniProt Q78TU8
>NP_899010.1|Pseudomona aeruginosa PA01|actin-associated protein FAM107A isoform 1
MYSEIQRERADIEGLMARPEYREWNSELIKPKKLLNPVKASRSHQELHRELLMNHKRGLGMDSKPELQRVLEHRRRNQLIKKKEEELEAKRMQCPFKQELLRRQQRLNQLENPPQRDEDHAPEFIKVRENLRRITTLTSEERAL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.12 | 1.12410630261226 | 2.5e-6 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)