Host taxon 10090
Protein NP_001334389.1
A-kinase anchor protein 7 isoform 2
Mus musculus
Gene Akap7, UniProt O55074
>NP_001334389.1|Pseudomona aeruginosa PA01|A-kinase anchor protein 7 isoform 2
MGQLCCFPFARDEGKICEKDRREPEDAELVRLSKRLVENAVLKAVQQYLEETQNKKQPGEGNSTKAEEGDRNGDGSDNNRK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.27 | -1.27201929861198 | 8.1e-11 | 32071273 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)