Host taxon 10090
Protein NP_032663.1
7,8-dihydro-8-oxoguanine triphosphatase precursor
Mus musculus
Gene Nudt1, UniProt P53368
>NP_032663.1|Pseudomona aeruginosa PA01|7,8-dihydro-8-oxoguanine triphosphatase precursor
MSTSRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGAKRELLEESGLSVDTLHKVGHISFEFVGSPELMDVHIFSADHVHGTPTESEEMRPQWFQLDQIPFADLWPDDSYWFPLLLQKKKFCGHFKFQDQDTILSYSLREVDSF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.16 | -2.15540014729264 | 0.021 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)