Host taxon 10090
Protein NP_079667.2
60S ribosome subunit biogenesis protein NIP7 homolog isoform 1
Mus musculus
Gene Nip7, UniProt Q9CXK8
>NP_079667.2|Pseudomona aeruginosa PA01|60S ribosome subunit biogenesis protein NIP7 homolog isoform 1
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEMMLKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWVKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.27 | 1.26541370113392 | 1.6e-7 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)