Host taxon 10090
Protein NP_001123956.1
60S ribosomal protein L35a
Mus musculus
Gene Rpl35a, UniProt O55142
>NP_001123956.1|Pseudomona aeruginosa PA01|60S ribosomal protein L35a
MSGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.62 | -1.61728460808457 | 0.00031 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)