Host taxon 10090
Protein NP_062621.2
60S ribosomal protein L21
Mus musculus
Gene Rpl21, UniProt Q9CQM8
>NP_062621.2|Pseudomona aeruginosa PA01|60S ribosomal protein L21
MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPELLEPIPYEFMA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.84 | -1.83707801469911 | 2.2e-10 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)