Host taxon 10090
Protein NP_080296.3
60S acidic ribosomal protein P2 isoform a
Mus musculus
Gene Rplp2, UniProt P99027
>NP_080296.3|Pseudomona aeruginosa PA01|60S acidic ribosomal protein P2 isoform a
MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGVGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.75 | 0.74719876917803 | 2.2e-13 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)