Host taxon 10090
Protein NP_056622.1
5'(3')-deoxyribonucleotidase, cytosolic type
Mus musculus
Gene Nt5c, UniProt Q9JM14
>NP_056622.1|Pseudomona aeruginosa PA01|5'(3')-deoxyribonucleotidase, cytosolic type
MAVKRPVRVLVDMDGVLADFESGLLQGFRRRFPEEPHVPLEQRRGFLANEQYGALRPDLAEKVASVYESPGFFLNLEPIPGALDALREMNDMKDTEVFICTTPLLKYDHCVGEKYRWVEQNLGPEFVERIILTRDKTVVMGDLLIDDKDNIQGLEETPSWEHILFTCCHNQHLALPPTRRRLLSWSDNWRGIIESKRASL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.87 | -0.87143773674594 | 0.017 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)