Host taxon 10090
Protein NP_444393.1
39S ribosomal protein L36, mitochondrial
Mus musculus
Gene Mrpl36, UniProt Q99N90
>NP_444393.1|Pseudomona aeruginosa PA01|39S ribosomal protein L36, mitochondrial
MAALLVRSVVASVVDPFLHLSRLAVKPRVFSSFLLGTLPRAKPCAEVRSVLCGRPLPTLLPSLGFKTKGVIKKRCKDCYKVKRRGRWFILCKTNPKHKQRQM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.31 | -2.30835532970598 | 5.5e-7 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)