Host taxon 10090
Protein NP_080072.2
39S ribosomal protein L33, mitochondrial
Mus musculus
Gene Mrpl33, UniProt Q9CQP0
>NP_080072.2|Pseudomona aeruginosa PA01|39S ribosomal protein L33, mitochondrial
MLLSAVSFAKSKSKTILVKLVSQAGTGFSFNHKRSRLREKLSLLHYDPIVNKKVLFVEQKKIRSL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.73 | 0.729236551852278 | 0.001 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)