Host taxon 10090
Protein NP_079577.1
39S ribosomal protein L17, mitochondrial precursor
Mus musculus
Gene Mrpl17, UniProt Q9D8P4
>NP_079577.1|Pseudomona aeruginosa PA01|39S ribosomal protein L17, mitochondrial precursor
MRLSLAAAISHGRVYRRLGLGPESRIHLLRNLLTGLVRHERIEATWARADEMRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFKVLAPRFQGQNGNYTRMLQIPNRKEQDRAKMAVIEYKGNYLPPLPLPHRDSNLTLLNQLLLGLQQDLHHNQDASLHSSCTVQTPKT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.66 | 0.660235149066932 | 0.0015 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)