Host taxon 10090
Protein NP_080430.1
39S ribosomal protein L10, mitochondrial isoform 1 precursor
Mus musculus
Gene Mrpl10, UniProt Q3TBW2
>NP_080430.1|Pseudomona aeruginosa PA01|39S ribosomal protein L10, mitochondrial isoform 1 precursor
MAAAVAGILRGGLPPRAAWLPTLQTVRHGSKAVTRHWRVMHFQRQKLMAITEYIPPKPAINPRCLPPPPKPPKEESGLVRLLRQDIVAVFRDNRMIAVCQNVALSAEDKLLLRHQLRKHKIFIKVFPSQVLKPFLENSKYRNLLPLFVGHNLLLVSEEPKVKEMVRVLKSVPFLPLLGGCVDDTILSRQGLVDYAKLPSLDQLQGQLVGGLTHLMAQTRYLLQHQPVQLTSLLDQYVKEQNEGDCATSANEKLHPPDPAPDA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.97 | -0.974878821016024 | 2.4e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)